Mouse Anti-PACAP Antibody (CBMOAB-53739FYA)
Cat: CBMOAB-53739FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-53739FYA | Monoclonal | Rhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Mallard (Anas platyrhynchos), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) | WB, ELISA | MO53739FYA | 100 µg | ||
MO-AB-03317Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03317Y | 100 µg | ||
MO-AB-09281Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO09281Y | 100 µg | ||
MO-AB-23572H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23572C | 100 µg | ||
MO-AB-25470W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25470W | 100 µg | ||
MO-AB-26814W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26814W | 100 µg | ||
MO-AB-27708H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27708C | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Mallard (Anas platyrhynchos), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) |
Clone | MO53739FYA |
Specificity | This antibody binds to Rhesus PACAP. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Rhesus PACAP Antibody is a mouse antibody against PACAP. It can be used for PACAP detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Pituitary adenylyl cyclase activating protein; PACAP |
UniProt ID | Q53BI5 |
Protein Refseq | The length of the protein is 62 amino acids long. The sequence is show below: GSLGGGVEEDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry