Mouse Anti-PACAP Antibody (CBMOAB-53739FYA)


Cat: CBMOAB-53739FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53739FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Mallard (Anas platyrhynchos), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO53739FYA 100 µg
MO-AB-03317Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03317Y 100 µg
MO-AB-09281Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09281Y 100 µg
MO-AB-23572H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23572C 100 µg
MO-AB-25470W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25470W 100 µg
MO-AB-26814W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26814W 100 µg
MO-AB-27708H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27708C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Mallard (Anas platyrhynchos), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO53739FYA
SpecificityThis antibody binds to Rhesus PACAP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PACAP Antibody is a mouse antibody against PACAP. It can be used for PACAP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPituitary adenylyl cyclase activating protein; PACAP
UniProt IDQ53BI5
Protein RefseqThe length of the protein is 62 amino acids long.
The sequence is show below: GSLGGGVEEDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL.
For Research Use Only | Not For Clinical Use.
Online Inquiry