Mouse Anti-PAH Antibody (CBMOAB-53772FYA)


Cat: CBMOAB-53772FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53772FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Marmoset, Silkworm (Bombyx mori), Zebrafish (Danio rerio) WB, ELISA MO53772FYA 100 µg
CBMOAB-91276FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO91276FYA 100 µg
MO-AB-03323Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03323Y 100 µg
MO-AB-17499R Monoclonal Cattle (Bos taurus) WB, ELISA MO17499R 100 µg
MO-AB-60914W Monoclonal Marmoset WB, ELISA MO60914W 100 µg
MO-AB-70211W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO70211W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Marmoset, Silkworm (Bombyx mori), Zebrafish (Danio rerio)
CloneMO53772FYA
SpecificityThis antibody binds to Rhesus PAH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the biopterin-dependent aromatic amino acid hydroxylase protein family. The encoded phenylalanine hydroxylase enzyme hydroxylates phenylalanine to tyrosine and is the rate-limiting step in phenylalanine catabolism. Deficiency of this enzyme activity results in the autosomal recessive disorder phenylketonuria. (From NCBI)
Product OverviewMouse Anti-Rhesus PAH Antibody is a mouse antibody against PAH. It can be used for PAH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPhenylalanine-4-hydroxylase; PAH
UniProt IDH9FL68
Protein RefseqThe length of the protein is 99 amino acids long.
The sequence is show below: AFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQHC.
For Research Use Only | Not For Clinical Use.
Online Inquiry