AibGenesis™ Mouse Anti-PAQR4 Antibody (CBMOAB-53861FYA)


Cat: CBMOAB-53861FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53861FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset WB, ELISA MO53861FYA 100 µg
MO-AB-06009H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06009C 100 µg
MO-AB-11934W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11934W 100 µg
MO-AB-17541R Monoclonal Cattle (Bos taurus) WB, ELISA MO17541R 100 µg
MO-AB-37928W Monoclonal Goat (Capra hircus) WB, ELISA MO37928W 100 µg
MO-AB-60987W Monoclonal Marmoset WB, ELISA MO60987W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset
CloneMO53861FYA
SpecificityThis antibody binds to Rhesus PAQR4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PAQR4 Antibody is a mouse antibody against PAQR4. It can be used for PAQR4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPAQR4
UniProt IDF6Z3K7
Protein RefseqThe length of the protein is 199 amino acids long.
The sequence is show below: MAFLAGPRLLDWASSPPHLQFNKFVLTGYRPASSGSGCLRSLFYLHNELGNIYTHGALPIIHCTLACRPWLRPAALVGYTVLSGVAGWRALTAPSTSARLRAFGWQAAARLLVFGARGVGLGSGAPGSLPCYLRMDALALLGGLVNVARLPERWGPGRFDYWGNSHQIMHLLSVGSILQLHAGVVPDLLWAAHHACPRD.
For Research Use Only | Not For Clinical Use.
Online Inquiry