Mouse Anti-PBS2 Antibody (CBMOAB-38218FYC)
Cat: CBMOAB-38218FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-38218FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans) | WB, ELISA | MO38218FC | 100 µg | ||
CBMOAB-08209HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO08209HB | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans) |
Clone | MO38218FC |
Specificity | This antibody binds to Arabidopsis PBS2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Arabidopsis PBS2 Antibody is a mouse antibody against PBS2. It can be used for PBS2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | PBS2; Fragment; PBS2 |
UniProt ID | B0ZWQ2 |
Protein Refseq | The length of the protein is 51 amino acids long. The sequence is show below: PFFHDGMKEWSCCKQRSHDFSLFLEIPGCKTGKHTTEKPVLAKSVPKHPXA. |
Reference
Reference | 1. Warren, R. F., Merritt, P. M., Holub, E., & Innes, R. W. (1999). Identification of three putative signal transduction genes involved in R gene-specified disease resistance in Arabidopsis. Genetics, 152(1), 401-412. 2. Glazebrook, J. (2001). Genes controlling expression of defense responses in Arabidopsis-2001 status. Current opinion in plant biology, 4(4), 301-308. |
See other products for " PBS2 "
CBMOAB-02827CR | Mouse Anti-PBS2 Antibody (CBMOAB-02827CR) |
For Research Use Only | Not For Clinical Use.
Online Inquiry