AibGenesis™ Mouse Anti-PCDH15 Antibody (CBMOAB-54003FYA)


Cat: CBMOAB-54003FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54003FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rabbit (Oryctolagus cuniculus) WB, ELISA MO54003FYA 100 µg
MO-AB-09294Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09294Y 100 µg
MO-AB-61079W Monoclonal Marmoset WB, ELISA MO61079W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rabbit (Oryctolagus cuniculus)
CloneMO54003FYA
SpecificityThis antibody binds to Rhesus PCDH15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the cadherin superfamily. Family members encode integral membrane proteins that mediate calcium-dependent cell-cell adhesion. It plays an essential role in maintenance of normal retinal and cochlear function. Mutations in this gene result in hearing loss and Usher Syndrome Type IF (USH1F). Extensive alternative splicing resulting in multiple isoforms has been observed in the mouse ortholog. Similar alternatively spliced transcripts are inferred to occur in human, and additional variants are likely to occur. (From NCBI)
Product OverviewMouse Anti-Rhesus PCDH15 Antibody is a mouse antibody against PCDH15. It can be used for PCDH15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtocadherin-15 isoform CD3-2; PCDH15
UniProt IDH9F4L9
Protein RefseqThe length of the protein is 205 amino acids long.
The sequence is show below: PAGQEEYGEVVGEAEEEYEEEEWARKRMIKLVVDREYETSSTGEDSAPECQRHRLHHPSIHSNINGNIYIAQNGSVVRTRRACLTDNLKVASPVRLGRHFKKLDKLAVTHEENMPLNTLSKGPFSTEKMNARPTLVTFAPCPVGTDNTAVKTLGNRLKSTVEQESMIDSKNIKEALEFHSDHTQSDDEELWMGPWNNLHIPMTKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry