Mouse Anti-PCDHGA8 Antibody (MO-AB-05036W)
Cat: MO-AB-05036W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-05036W | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) | WB, ELISA | MO05036W | 100 µg | ||
| MO-AB-10917W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO10917W | 100 µg | ||
| MO-AB-17607R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO17607R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) |
| Clone | MO05036W |
| Specificity | This antibody binds to Rhesus PCDHGA8. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus PCDHGA8 Antibody is a mouse antibody against PCDHGA8. It can be used for PCDHGA8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protocadherin gamma-A8 isoform 1; PCDHGA8 |
| UniProt ID | H9FD46 |
| Protein Refseq | The length of the protein is 125 amino acids long. The sequence is show below: LVVAVAAVSCVFLAFVVVLLGLRLRRWHKSRLLQGSGGRLVGVPASHFVGVEEVQAFLQTYSHEVSLTADSRKSHLIFPQPNYADTLISQESCEKNDSLLTSIDFHECKNEADRGQQAPPNTDWR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry