AibGenesis™ Mouse Anti-Pcmt Antibody (CBMOAB-27336FYA)


Cat: CBMOAB-27336FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-27336FYA Monoclonal Fruit fly (Drosophila melanogaster), Zebrafish (Danio rerio) WB, ELISA MO27336FYA 100 µg
CBMOAB-91862FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO91862FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Zebrafish (Danio rerio)
CloneMO27336FYA
SpecificityThis antibody binds to fruit fly Pcmt.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Pcmt Antibody is a mouse antibody against Pcmt. It can be used for Pcmt detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein-L-isoaspartate(D-aspartate) O-methyltransferase; PIMT; EC 2.1.1.77; L-isoaspartyl protein carboxyl methyltransferase; Protein L-isoaspartyl/D-aspartyl methyltransferase; Protein-beta-aspartate methyltransferase; dPIMT; Pcmt; PIAM
UniProt IDQ27869
Protein RefseqThe length of the protein is 226 amino acids long.
The sequence is show below: MAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTISAPHMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQYMQQYDKDANGKVEMTRLMGVMYVPLTDLRS.
For Research Use Only | Not For Clinical Use.
Online Inquiry