AibGenesis™ Mouse Anti-PD1 Antibody (MO-AB-28165R)


Cat: MO-AB-28165R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-28165R Monoclonal Pig (Sus scrofa), A. thaliana (Arabidopsis thaliana) WB, ELISA MO28165R 100 µg
MO-DKB-02468W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa), A. thaliana (Arabidopsis thaliana)
CloneMO28165R
SpecificityThis antibody binds to Pig PD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against PD1. It can be used for PD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMHC class I antigen; PD1; SLA-1
UniProt IDO19244
Protein RefseqThe length of the protein is 361 amino acids long.
The sequence is show below: MGPGALFLLLSGTLALTGTQAGPHSLSYFYTAVSRPDRGDSRFIAVGYVDDTQFVRFDNYAPNPRMEPRVPWIQQEGQEYWDRETRNVKETAQTYGVGLNTLRGYYNQSEAGSHTLQSMYGCYLGPDGLLLHGYRQDAYDGADYIALNEDLRSWTAADMAAQITKRKWEAADEAERRRSYLQGLCVESLRRYLEMGKDTLQRAEPPKTHVTRHPSSDLGVTLRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGTFQKWAALVVPPGEEQSYTCHVQHEGLQEPLTLRWDPAQPPVPIVGIIVGLVLVLVAGAMVAGVVIWRKTRSGEKGGSYTQAAGSDSDQGSDVSLTKDPRV.
For Research Use Only | Not For Clinical Use.
Online Inquiry