AibGenesis™ Mouse Anti-Pdcl Antibody (CBMOAB-27653FYA)


Cat: CBMOAB-27653FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-27653FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO27653FYA 100 µg
CBMOAB-54094FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO54094FYA 100 µg
CBMOAB-91972FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO91972FYA 100 µg
MO-AB-17661R Monoclonal Cattle (Bos taurus) WB, ELISA MO17661R 100 µg
MO-AB-25777W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25777W 100 µg
MO-AB-61172W Monoclonal Marmoset WB, ELISA MO61172W 100 µg
MO-DKB-00930W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, IF, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO27653FYA
SpecificityThis antibody binds to fruit fly Pdcl.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Pdcl Antibody is a mouse antibody against Pdcl. It can be used for Pdcl detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPhosducin-like protein; PHLP
UniProt IDQ9VUR7
Protein RefseqThe length of the protein is 276 amino acids long.
The sequence is show below: MATLEDKLLGEKLEYYCSSSEGEDNGDEGGDNKGASGKSRCSGLTIDTNPDATPAGGFRQQSSTNTGPKGVVKDWQRFKQLEAERRDETERQRLALAKKLTITATTSAEDEERKRQEELDAELDELMSEDFLQQYQKQRMAEMLRQTGHHQQFGQVQQLTSHEEFLACVEQENKHTTIIIHIYERQLAACATLNKCLDSLASDYPSIKFAKICSSVAGMSRDFRTKGLPALLVYKAQAVIGNFVRLTDDLSDDFFASDVESFLIEHGIIVDRALYN.
For Research Use Only | Not For Clinical Use.
Online Inquiry