AibGenesis™ Mouse Anti-PDGFC Antibody (CBMOAB-54151FYA)


Cat: CBMOAB-54151FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54151FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO54151FYA 100 µg
MO-AB-24079W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24079W 100 µg
MO-AB-61210W Monoclonal Marmoset WB, ELISA MO61210W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO54151FYA
SpecificityThis antibody binds to Rhesus PDGFC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines. This gene product appears to form only homodimers. It differs from the platelet-derived growth factor alpha and beta polypeptides in having an unusual N-terminal domain, the CUB domain. Alternatively spliced transcript variants have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus PDGFC Antibody is a mouse antibody against PDGFC. It can be used for PDGFC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPlatelet-derived growth factor C; PDGFC
UniProt IDH9FBJ5
Protein RefseqThe length of the protein is 118 amino acids long.
The sequence is show below: VFGRKSRVMDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG.
For Research Use Only | Not For Clinical Use.
Online Inquiry