AibGenesis™ Mouse Anti-PDHX Antibody (CBMOAB-54166FYA)


Cat: CBMOAB-54166FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54166FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO54166FYA 100 µg
CBMOAB-92061FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92061FYA 100 µg
MO-AB-06138H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06138C 100 µg
MO-AB-11129W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11129W 100 µg
MO-AB-17707R Monoclonal Cattle (Bos taurus) WB, ELISA MO17707R 100 µg
MO-AB-23583H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23583C 100 µg
MO-AB-61228W Monoclonal Marmoset WB, ELISA MO61228W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Marmoset, Zebrafish (Danio rerio)
CloneMO54166FYA
SpecificityThis antibody binds to Rhesus PDHX.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe pyruvate dehydrogenase (PDH) complex is located in the mitochondrial matrix and catalyzes the conversion of pyruvate to acetyl coenzyme A. The PDH complex thereby links glycolysis to Krebs cycle. The PDH complex contains three catalytic subunits, E1, E2, and E3, two regulatory subunits, E1 kinase and E1 phosphatase, and a non-catalytic subunit, E3 binding protein (E3BP). This gene encodes the E3 binding protein subunit; also known as component X of the pyruvate dehydrogenase complex. This protein tethers E3 dimers to the E2 core of the PDH complex. Defects in this gene are a cause of pyruvate dehydrogenase deficiency which results in neurological dysfunction and lactic acidosis in infancy and early childhood. This protein is also a minor antigen for antimitochondrial antibodies. These autoantibodies are present in nearly 95% of patients with the autoimmune liver disease primary biliary cirrhosis (PBC). In PBC, activated T lymphocytes attack and destroy epithelial cells in the bile duct where this protein is abnormally distributed and overexpressed. PBC eventually leads to cirrhosis and liver failure. Alternative splicing results in multiple transcript variants encoding distinct isoforms. (From NCBI)
Product OverviewMouse Anti-Rhesus PDHX Antibody is a mouse antibody against PDHX. It can be used for PDHX detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPDHX
UniProt IDF7HS46
Protein RefseqThe length of the protein is 501 amino acids long.
The sequence is show below: MAASWRLGCDPRLLRYLVGFPGCRSIGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPRTLRFRLSPAARNILEKHSLDASQGTATGSFSIGSKSKCFKILDMVRTSSIPCLLKVRVEKSVPDASSPLYLTKIPLFYRVIQSPKQTHLWRNYLGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATDKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLENPIRLA.
For Research Use Only | Not For Clinical Use.
Online Inquiry