Mouse Anti-PDK1 Antibody (CBMOAB-54175FYA)


Cat: CBMOAB-54175FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54175FYA Monoclonal Rhesus (Macaca mulatta), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Chicken (Gallus gallus), Primate, Zebrafish (Danio rerio), Marmoset, Tomato (Lycopersicon esculentum) WB, ELISA MO54175FYA 100 µg
Inquiry
CBMOAB-27390FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO27390FYA 100 µg
Inquiry
CBMOAB-92082FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92082FYA 100 µg
Inquiry
CBMOAB-08277HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO08277HB 100 µg
Inquiry
MO-AB-22683W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22683W 100 µg
Inquiry
MO-AB-61238W Monoclonal Marmoset WB, ELISA MO61238W 100 µg
Inquiry
MO-AB-06147H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06147C 100 µg
Inquiry
MO-AB-34997H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO34997C 100 µg
Inquiry
MO-DKB-03162W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Chicken (Gallus gallus), Primate, Zebrafish (Danio rerio) WB, IB 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Chicken (Gallus gallus), Primate, Zebrafish (Danio rerio), Marmoset, Tomato (Lycopersicon esculentum)
CloneMO54175FYA
SpecificityThis antibody binds to Rhesus PDK1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. Multiple alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Rhesus PDK1 Antibody is a mouse antibody against PDK1. It can be used for PDK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPyruvate dehydrogenase kinase, isozyme 1; PDK1
UniProt IDH9Z3K0
Protein RefseqThe length of the protein is 436 amino acids long.
The sequence is show below: MRLARLLRGAALAVPGPGLRAAGPSRSFSSDSGSGPAPERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVVEVIKDGYENARRLCDLYYINSPELELGELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA.
See other products for " PDK1 "
CBMOAB-38493FYCMouse Anti-PDK1 Antibody (CBMOAB-38493FYC)
For Research Use Only | Not For Clinical Use.
Online Inquiry