AibGenesis™ Mouse Anti-PDK1 Antibody (CBMOAB-54175FYA)
Cat: CBMOAB-54175FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-54175FYA | Monoclonal | Rhesus (Macaca mulatta), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Chicken (Gallus gallus), Primate, Zebrafish (Danio rerio), Marmoset, Tomato (Lycopersicon esculentum) | WB, ELISA | MO54175FYA | 100 µg | ||
| CBMOAB-27390FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO27390FYA | 100 µg | ||
| CBMOAB-92082FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO92082FYA | 100 µg | ||
| CBMOAB-08277HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO08277HB | 100 µg | ||
| MO-AB-22683W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO22683W | 100 µg | ||
| MO-AB-61238W | Monoclonal | Marmoset | WB, ELISA | MO61238W | 100 µg | ||
| MO-AB-06147H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO06147C | 100 µg | ||
| MO-AB-34997H | Monoclonal | Tomato (Lycopersicon esculentum) | WB, ELISA | MO34997C | 100 µg | ||
| MO-DKB-03162W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Chicken (Gallus gallus), Primate, Zebrafish (Danio rerio) | WB, IB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Chicken (Gallus gallus), Primate, Zebrafish (Danio rerio), Marmoset, Tomato (Lycopersicon esculentum) |
| Clone | MO54175FYA |
| Specificity | This antibody binds to Rhesus PDK1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. Multiple alternatively spliced transcript variants have been found for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus PDK1 Antibody is a mouse antibody against PDK1. It can be used for PDK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Pyruvate dehydrogenase kinase, isozyme 1; PDK1 |
| UniProt ID | H9Z3K0 |
| Protein Refseq | The length of the protein is 436 amino acids long. The sequence is show below: MRLARLLRGAALAVPGPGLRAAGPSRSFSSDSGSGPAPERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVVEVIKDGYENARRLCDLYYINSPELELGELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA. |
See other products for " PDK1 "
| CBMOAB-38493FYC | AibGenesis™ Mouse Anti-PDK1 Antibody (CBMOAB-38493FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry