Mouse Anti-PEX12 Antibody (CBMOAB-02905CR)


Cat: CBMOAB-02905CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-02905CR Monoclonal Yeast, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO02905CR 100 µg
CBMOAB-27472FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO27472FYA 100 µg
CBMOAB-38646FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO38646FC 100 µg
CBMOAB-54298FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO54298FYA 100 µg
CBMOAB-92232FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92232FYA 100 µg
MO-AB-06185H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06185C 100 µg
MO-AB-11684W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11684W 100 µg
MO-AB-17777R Monoclonal Cattle (Bos taurus) WB, ELISA MO17777R 100 µg
MO-AB-61315W Monoclonal Marmoset WB, ELISA MO61315W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO02905CR
SpecificityThis antibody binds to Yeast PEX12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPeroxisome; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the peroxin-12 family. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of Zellweger syndrome (ZWS). (From NCBI)
Product OverviewMouse Anti-Yeast PEX12 Antibody is a mouse antibody against PEX12. It can be used for PEX12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPeroxisome assembly protein 12; Peroxin-12; PEX12; YMR026C
UniProt IDQ04370
Protein RefseqThe length of the protein is 399 amino acids long. The sequence is show below: MSFYSNLPSAGQSSRGSSTSGRNGVGLEPLYPTIFEIMSSQEIDSLLPASIRYLLANHLVANFPNRYTLRLNKYFFEWFQAIKGFVEWYHLKTYNSTFIDRFYGLQLFSSRDRNLALTQCLNPKGQSEWPQGLQLNQQQKSVIFLEKIILPYITAKLDEILEKISMNNIFSSDETENKWPKRAFLRIYPFIKKLLALSNLLVKLLFLTKRTGSVSLLQYLFKIEYTTVRPLSSELSGLKETKGMDNRLRKTNISSIFALMQGQLSIIPRFLTFMGSQFFPTFIFVLRVYQWWTTQDMTTKLQKRVNDLDEDIPRPPFSSHSDKTEDKEGVSEACPVCEKTVQNPCVLETGYVACYPCAISYLVNNEGHCPVTNKKLLGCTYNKHTNKWEVVTGIRKLLI.
For Research Use Only | Not For Clinical Use.
Online Inquiry