Mouse Anti-PEX12 Antibody (CBMOAB-02905CR)
Cat: CBMOAB-02905CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-02905CR | Monoclonal | Yeast, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO02905CR | 100 µg | ||
CBMOAB-27472FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO27472FYA | 100 µg | ||
CBMOAB-38646FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO38646FC | 100 µg | ||
CBMOAB-54298FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO54298FYA | 100 µg | ||
CBMOAB-92232FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO92232FYA | 100 µg | ||
MO-AB-06185H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO06185C | 100 µg | ||
MO-AB-11684W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11684W | 100 µg | ||
MO-AB-17777R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO17777R | 100 µg | ||
MO-AB-61315W | Monoclonal | Marmoset | WB, ELISA | MO61315W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
Clone | MO02905CR |
Specificity | This antibody binds to Yeast PEX12. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Peroxisome; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene belongs to the peroxin-12 family. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of Zellweger syndrome (ZWS). |
Product Overview | Mouse Anti-Yeast PEX12 Antibody is a mouse antibody against PEX12. It can be used for PEX12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Peroxisome assembly protein 12; Peroxin-12; PEX12; YMR026C |
UniProt ID | Q04370 |
Protein Refseq | The length of the protein is 399 amino acids long. The sequence is show below: MSFYSNLPSAGQSSRGSSTSGRNGVGLEPLYPTIFEIMSSQEIDSLLPASIRYLLANHLVANFPNRYTLRLNKYFFEWFQAIKGFVEWYHLKTYNSTFIDRFYGLQLFSSRDRNLALTQCLNPKGQSEWPQGLQLNQQQKSVIFLEKIILPYITAKLDEILEKISMNNIFSSDETENKWPKRAFLRIYPFIKKLLALSNLLVKLLFLTKRTGSVSLLQYLFKIEYTTVRPLSSELSGLKETKGMDNRLRKTNISSIFALMQGQLSIIPRFLTFMGSQFFPTFIFVLRVYQWWTTQDMTTKLQKRVNDLDEDIPRPPFSSHSDKTEDKEGVSEACPVCEKTVQNPCVLETGYVACYPCAISYLVNNEGHCPVTNKKLLGCTYNKHTNKWEVVTGIRKLLI. |
For Research Use Only | Not For Clinical Use.
Online Inquiry