Mouse Anti-PEX14 Antibody (CBMOAB-02907CR)
Cat: CBMOAB-02907CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-02907CR | Monoclonal | Yeast, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO02907CR | 100 µg | ||
| CBMOAB-27475FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO27475FYA | 100 µg | ||
| CBMOAB-38648FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO38648FC | 100 µg | ||
| CBMOAB-54300FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO54300FYA | 100 µg | ||
| CBMOAB-92236FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO92236FYA | 100 µg | ||
| MO-AB-13813W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13813W | 100 µg | ||
| MO-AB-17779R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO17779R | 100 µg | ||
| MO-AB-61319W | Monoclonal | Marmoset | WB, ELISA | MO61319W | 100 µg | ||
| MO-DKB-00081W | Polyclonal | A. thaliana (Arabidopsis thaliana) | ELISA | 100 µg | |||
| MO-DKB-00082W | Polyclonal | A. thaliana (Arabidopsis thaliana) | IA | 100 µg | |||
| MO-DKB-00084W | Polyclonal | A. thaliana (Arabidopsis thaliana) | ELISA, WB | 100 µg | |||
| MO-DKB-01721W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO02907CR |
| Specificity | This antibody binds to Yeast PEX14. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Peroxisome; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes an essential component of the peroxisomal import machinery. The protein is integrated into peroxisome membranes with its C-terminus exposed to the cytosol, and interacts with the cytosolic receptor for proteins containing a PTS1 peroxisomal targeting signal. The protein also functions as a transcriptional corepressor and interacts with a histone deacetylase. A mutation in this gene results in one form of Zellweger syndrome. |
| Product Overview | Mouse Anti-Yeast PEX14 Antibody is a mouse antibody against PEX14. It can be used for PEX14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Peroxisomal membrane protein PEX14; Peroxin-14; PEX14; YGL153W |
| UniProt ID | P53112 |
| Protein Refseq | The length of the protein is 341 amino acids long. The sequence is show below: MSDVVSKDRKALFDSAVSFLKDESIKDAPLLKKIEFLKSKGLTEKEIEIAMKEPKKDGIVGDEVSKKIGSTENRASQDMYLYEAMPPTLPHRDWKDYFVMATATAGLLYGAYEVTRRYVIPNILPEAKSKLEGDKKEIDDQFSKIDTVLNAIEAEQAEFRKKESETLKELSDTIAELKQALVQTTRSREKIEDEFRIVKLEVVNMQNTIDKFVSDNDGMQELNNIQKEMESLKSLMNNRMESGNAQDNRLFSISPNGIPGIDTIPSASEILAKMGMQEESDKEKENGSDANKDDNAVPAWKKAREQTIDSNASIPEWQKNTAANEISVPDWQNGQVEDSIP. |
For Research Use Only | Not For Clinical Use.
Online Inquiry