Mouse Anti-PEX19 Antibody (CBMOAB-02911CR)
Cat: CBMOAB-02911CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-02911CR | Monoclonal | Yeast, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO02911CR | 100 µg | ||
CBMOAB-27479FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO27479FYA | 100 µg | ||
CBMOAB-92241FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO92241FYA | 100 µg | ||
MO-AB-06187H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO06187C | 100 µg | ||
MO-AB-10369W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO10369W | 100 µg | ||
MO-AB-17782R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO17782R | 100 µg | ||
MO-AB-43350W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43350W | 100 µg | ||
MO-AB-61323W | Monoclonal | Marmoset | WB, ELISA | MO61323W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Marmoset, Zebrafish (Danio rerio) |
Clone | MO02911CR |
Specificity | This antibody binds to Yeast PEX19. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Peroxisome; Endoplasmic reticulum; Other locations; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Required for proper post-translational import and stabilization of peroxisomal membrane proteins (PMPs). Acts as a cytosolic import receptor for PMPs and delivers them to the docking factor PEX3 at the peroxisomal membrane for subsequent insertion into the membrane. Acts as a chaperone in stabilizing or maintaining PMPs in the lipid bilayer. Directs PEX17, a peripheral component of the peroxisomal matrix protein translocation machinery, to peroxisomes. Stabilizes VPS1, a protein required for peroxisomal fission, at the peroxisomal membrane. Also acts in conjunction with PEX3 in the formation of peroxisomes from preperoxisomal compartments at the endoplasmic reticulum during de novo peroxisome synthesis, probably via the import of additional PMPs. (From uniprot, under CC BY 4.0) |
Product Overview | Mouse Anti-Yeast PEX19 Antibody is a mouse antibody against PEX19. It can be used for PEX19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Peroxisomal membrane protein import receptor PEX19; Peroxin-19; PEX19; PAS12; YDL065C |
UniProt ID | Q07418 |
Protein Refseq | The length of the protein is 342 amino acids long. The sequence is show below: MNENEYDNFDDLDDLLDEDPTKLDEAEPDDVQAKGSVYNDSENKEKNAESKDSDGVQVANESEEDPELKEMMVDLQNEFANLMKNNGNENNVKTEDFNKLISALEEAAKVPHQQMEQGCSSLKSNSTDKGTVNGSNPGFKNIVSNTLDRLKENGNKVDTSLAEETKESQRSGQNNNIDDILSQLLDQMVASGGKESAENQFDLKDGEMDDAITKILDQMTSKEVLYEPMKEMRSEFGVWFQENGENEEHKEKIGTYKRQFNIVDEIVNIYELKDYDELKHKDRVTELLDELEQLGDSPIRSANSPLKHGNEEEELMKMLEIDGNDPNLGNLDKELTDGCKQQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry