AibGenesis™ Mouse Anti-PFDN2 Antibody (CBMOAB-54326FYA)


Cat: CBMOAB-54326FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54326FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO54326FYA 100 µg
CBMOAB-92261FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92261FYA 100 µg
MO-AB-11765W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11765W 100 µg
MO-AB-17794R Monoclonal Cattle (Bos taurus) WB, ELISA MO17794R 100 µg
MO-AB-27820H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27820C 100 µg
MO-AB-61342W Monoclonal Marmoset WB, ELISA MO61342W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO54326FYA
SpecificityThis antibody binds to Rhesus PFDN2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. (From NCBI)
Product OverviewMouse Anti-Rhesus PFDN2 Antibody is a mouse antibody against PFDN2. It can be used for PFDN2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPrefoldin subunit 2; PFDN2
UniProt IDH9FL91
Protein RefseqThe length of the protein is 121 amino acids long.
The sequence is show below: SGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEK.
For Research Use Only | Not For Clinical Use.
Online Inquiry