AibGenesis™ Mouse Anti-Pgc Antibody (CBMOAB-27525FYA)
Cat: CBMOAB-27525FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-27525FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Pig (Sus scrofa), Plants, Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) | WB, ELISA | MO27525FYA | 100 µg | ||
| CBMOAB-54357FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO54357FYA | 100 µg | ||
| MO-AB-05104W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO05104W | 100 µg | ||
| MO-AB-09323Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO09323Y | 100 µg | ||
| MO-AB-28227R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28227R | 100 µg | ||
| MO-AB-42305W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42305W | 100 µg | ||
| MOF032922W165 | Polyclonal | Plants | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Pig (Sus scrofa), Plants, Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) |
| Clone | MO27525FYA |
| Specificity | This antibody binds to fruit fly Pgc. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes an aspartic proteinase that belongs to the peptidase family A1. The encoded protein is a digestive enzyme that is produced in the stomach and constitutes a major component of the gastric mucosa. This protein is also secreted into the serum. This protein is synthesized as an inactive zymogen that includes a highly basic prosegment. This enzyme is converted into its active mature form at low pH by sequential cleavage of the prosegment that is carried out by the enzyme itself. Polymorphisms in this gene are associated with susceptibility to gastric cancers. Serum levels of this enzyme are used as a biomarker for certain gastric diseases including Helicobacter pylori related gastritis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 1. (From NCBI) |
| Product Overview | Mouse Anti-D. melanogaster Pgc Antibody is a mouse antibody against Pgc. It can be used for Pgc detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | RE14873p; pgc; CG11296 |
| UniProt ID | Q8SZ69 |
| Protein Refseq | The length of the protein is 75 amino acids long. The sequence is show below: MHSFLKSICPCIQMFAFVKTRIVLSLYQVINLYQSIAYGCPRSKNGNNLPSVLHLMYSRTSREARNFSNTYPKNR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry