AibGenesis™ Mouse Anti-pgls Antibody (CBMOAB-92327FYA)


Cat: CBMOAB-92327FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-92327FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO92327FYA 100 µg
MO-AB-10837W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10837W 100 µg
MO-AB-17832R Monoclonal Cattle (Bos taurus) WB, ELISA MO17832R 100 µg
MO-AB-61381W Monoclonal Marmoset WB, ELISA MO61381W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO92327FYA
SpecificityThis antibody binds to Zebrafish pgls.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish pgls Antibody is a mouse antibody against pgls. It can be used for pgls detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namespgls; 6-Phosphogluconolactonase
UniProt IDF1R0C0
Protein RefseqThe length of the protein is 254 amino acids long.
The sequence is show below: MSGRRVLVFSSVGELGSSLAQLLSSRAEKALSSGGSCFSLGLSGGSLVSILSKELPAVPNLDCSKWLIGFCDERLVPFSDPESTYGLYKNQLFGKINIPEERILAIDPSLPVKECAEDYASKLSKAFSTEKIPVFDVLLLGMGPDGHTCSLFPDHPLLQERQKTVAPISDSPKPPPQRVTMTLPMVNAARCVVFVSTGGSKAPVLKHVLEGGEGPALPAALVSPDQGELFWLLDEPAAASLTSPVERPGPGAKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry