AibGenesis™ Mouse Anti-PGM Antibody (MO-AB-32188H)


Cat: MO-AB-32188H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-32188H Monoclonal Soybean (Glycine max), E. coli (Escherichia coli ), Fruit fly (Drosophila melanogaster), O. mykiss (Oncorhynchus mykiss) WB, ELISA MO32188C 100 µg
CBMOAB-2015YC Monoclonal E. coli (Escherichia coli ) WB, ELISA MO2015YC 100 µg
CBMOAB-27543FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO27543FYA 100 µg
MO-AB-12765Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO12765Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySoybean (Glycine max), E. coli (Escherichia coli ), Fruit fly (Drosophila melanogaster), O. mykiss (Oncorhynchus mykiss)
CloneMO32188C
SpecificityThis antibody binds to Soybean PGM.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against PGM. It can be used for PGM detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPhosphoglycerate mutase-like protein; PGM
UniProt IDQ8LGT9
Protein RefseqThe length of the protein is 284 amino acids long.
The sequence is show below: MDTAAGQSLYPLHRCKTLHLVRHAQGFHNVEGEKNFEAYKSYDLFDANLTPLGWKQVDNLRQHVKASGLSKRIELVIVSPLLRTMQTAVGVFGGQPYTDGINVPPLMNDNVGDSGRPAISSLNAPPFIAVELCREHLGVHPCDKRRNITDYRHMFPAIDFSLIENDEDILWKPDIREKNEEVAARGLKFLEWLWTRKEKEIAVVTHSGFLFHSLSAFGNDCHPNVKNEICTHFANCELRSMVIIDRGMIGSDESSTNYPGKVPDGLDLPSDVADQKHPENGQAN.
For Research Use Only | Not For Clinical Use.
Online Inquiry