AibGenesis™ Mouse Anti-PGPEP1 Antibody (CBMOAB-54382FYA)


Cat: CBMOAB-54382FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54382FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO54382FYA 100 µg
CBMOAB-92349FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92349FYA 100 µg
MO-AB-06211H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06211C 100 µg
MO-AB-16636W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16636W 100 µg
MO-AB-27844H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27844C 100 µg
MO-AB-61389W Monoclonal Marmoset WB, ELISA MO61389W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO54382FYA
SpecificityThis antibody binds to Rhesus PGPEP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe gene encodes a cysteine protease and member of the peptidase C15 family of proteins. The encoded protein cleaves amino terminal pyroglutamate residues from protein substrates including thyrotropin-releasing hormone and other neuropeptides. Expression of this gene may be downregulated in colorectal cancer, while activity of the encoded protein may be negatively correlated with cancer progression in colorectal cancer patients. Activity of the encoded protease may also be altered in other disease states including in liver cirrhosis, which is associated with reduced protease activity, and in necrozoospermia, which is associated with elevated protease activity. (From NCBI)
Product OverviewMouse Anti-Rhesus PGPEP1 Antibody is a mouse antibody against PGPEP1. It can be used for PGPEP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPyroglutamyl-peptidase 1; PGPEP1
UniProt IDH9FBD3
Protein RefseqThe length of the protein is 145 amino acids long.
The sequence is show below: HSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTISQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQLGRALRAIIEEMLDLLEQSEGKINYCHKH.
For Research Use Only | Not For Clinical Use.
Online Inquiry