AibGenesis™ Mouse Anti-PHLDA3 Antibody (CBMOAB-54459FYA)


Cat: CBMOAB-54459FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54459FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO54459FYA 100 µg
CBMOAB-92469FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92469FYA 100 µg
MO-AB-14881W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14881W 100 µg
MO-AB-27857H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27857C 100 µg
MO-AB-35411W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35411W 100 µg
MO-AB-61458W Monoclonal Marmoset WB, ELISA MO61458W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO54459FYA
SpecificityThis antibody binds to Rhesus PHLDA3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Introductionp53/tp53-regulated repressor of Akt/akt1 signaling. Represses akt1 by preventing akt1-binding to membrane lipids, thereby inhibiting akt1 translocation to the cellular membrane and activation. Contributes to p53/tp53-dependent apoptosis by repressing akt1 activity. Its direct transcription regulation by p53/tp53 may explain how p53/tp53 can negatively regulate akt1. May act as a tumor suppressor. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus PHLDA3 Antibody is a mouse antibody against PHLDA3. It can be used for PHLDA3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPHLDA3
UniProt IDF7FU44
Protein RefseqThe length of the protein is 104 amino acids long.
The sequence is show below: XLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS.
For Research Use Only | Not For Clinical Use.
Online Inquiry