Mouse Anti-Pig ABCE1 Antibody (MO-AB-23451R)


Cat: MO-AB-23451R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO23451R
SpecificityThis antibody binds to Pig ABCE1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action. Two transcript variants encoding the same protein have been found for this gene.
Product OverviewThis product is a mouse antibody against ABCE1. It can be used for ABCE1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP-binding cassette, sub-family E (OABP), member 1; ABCE1
UniProt IDK9J4N5
Protein RefseqThe length of the protein is 599 amino acids long.
The sequence is show below: MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINPDRYIIVVEHDLSVLDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKSTGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGIPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD.
See other products for " ABCE1 "
CBMOAB-1307FYCMouse Anti-Arabidopsis ABCE1 Antibody (CBMOAB-1307FYC)
MO-AB-01130HMouse Anti-Frog abce1 Antibody (MO-AB-01130H)
MO-AB-06762RMouse Anti-Cattle ABCE1 Antibody (MO-AB-06762R)
CBMOAB-64405FYAMouse Anti-Zebrafish abce1 Antibody (CBMOAB-64405FYA)
MO-AB-11411WMouse Anti-Chimpanzee ABCE1 Antibody (MO-AB-11411W)
CBMOAB-00178HCBMouse Anti-C. elegans ABCE1 Antibody (CBMOAB-00178HCB)
MO-AB-50209WMouse Anti-Marmoset ABCE1 Antibody (MO-AB-50209W)
For Research Use Only | Not For Clinical Use.
Online Inquiry