Cat: MO-AB-23455R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO23455R |
Specificity | This antibody binds to Pig ABCG5. |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. The protein encoded by this gene functions as a half-transporter to limit intestinal absorption and promote biliary excretion of sterols. It is expressed in a tissue-specific manner in the liver, colon, and intestine. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG8. Mutations in this gene may contribute to sterol accumulation and atheroschlerosis, and have been observed in patients with sitosterolemia. |
Product Overview | This product is a mouse antibody against ABCG5. It can be used for ABCG5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ATP-binding cassette sub-family G member 5, Fragment; ABCG5 |
UniProt ID | A4URS8 |
Protein Refseq | The length of the protein is 90 amino acids long. The sequence is show below: ARGYFTFQKYCSEILVVNEFYGQNFTCSSNASVSTNPMCALSQGIQFIERTCPGATSRFTTNFVILYSFIPTLVILGIIVFKIRDHLISR. |
See other products for " Abcg5 "
MO-AB-23939H | Mouse Anti-Rat Abcg5 Antibody (MO-AB-23939H) |
MO-AB-06784R | Mouse Anti-Cattle ABCG5 Antibody (MO-AB-06784R) |
CBMOAB-64431FYA | Mouse Anti-Zebrafish abcg5 Antibody (CBMOAB-64431FYA) |
CBMOAB-1353FYC | Mouse Anti-Arabidopsis ABCG5 Antibody (CBMOAB-1353FYC) |
For Research Use Only | Not For Clinical Use.