Mouse Anti-Pig ABCG5 Antibody (MO-AB-23455R)


Cat: MO-AB-23455R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO23455R
SpecificityThis antibody binds to Pig ABCG5.
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. The protein encoded by this gene functions as a half-transporter to limit intestinal absorption and promote biliary excretion of sterols. It is expressed in a tissue-specific manner in the liver, colon, and intestine. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG8. Mutations in this gene may contribute to sterol accumulation and atheroschlerosis, and have been observed in patients with sitosterolemia.
Product OverviewThis product is a mouse antibody against ABCG5. It can be used for ABCG5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP-binding cassette sub-family G member 5, Fragment; ABCG5
UniProt IDA4URS8
Protein RefseqThe length of the protein is 90 amino acids long.
The sequence is show below: ARGYFTFQKYCSEILVVNEFYGQNFTCSSNASVSTNPMCALSQGIQFIERTCPGATSRFTTNFVILYSFIPTLVILGIIVFKIRDHLISR.
For Research Use Only | Not For Clinical Use.

Online Inquiry