Mouse Anti-Pig ALR Antibody (MO-AB-23691R)
Cat: MO-AB-23691R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO23691R |
Specificity | This antibody binds to Pig ALR. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Catalyzes the interconversion of L-alanine and D-alanine. Provides the D-alanine required for cell wall biosynthesis. |
Product Overview | This product is a mouse antibody against ALR. It can be used for ALR detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Sulfhydryl oxidase; EC 1.8.3.2, Fragment; ALR |
UniProt ID | P79310 |
Protein Refseq | The length of the protein is 35 amino acids long. The sequence is show below: MRTQQKRDSKFREDCPPDREELGRHSWAVPHTLAA. |
See other products for " ALR "
MO-AB-43645W | Mouse Anti-Horse ALR Antibody (MO-AB-43645W) |
CBMOAB-0087YC | Mouse Anti-E. coli alr Antibody (CBMOAB-0087YC) |
CBMOAB-00881FYA | Mouse Anti-D. melanogaster Alr Antibody (CBMOAB-00881FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry