Mouse Anti-Pig APOM Antibody (MO-AB-23822R)


Cat: MO-AB-23822R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO23822R
SpecificityThis antibody binds to Pig APOM.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Alternate splicing results in both coding and non-coding variants of this gene.
Product OverviewThis product is a mouse antibody against APOM. It can be used for APOM detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesApolipoprotein M; APOM
UniProt IDA5D9L6
Protein RefseqThe length of the protein is 116 amino acids long.
The sequence is show below: MAAGSVPMQLQLRATIRTKNGLCVPRKWIYRLSEGNTDLRTEGRPDMKTKLFSSTCPGGIMLKETGQGYQRFLLYNRSPHPPEKCVEEFQSLTSCLDFKAFLLTPRNQEACELSSN.
For Research Use Only | Not For Clinical Use.
Online Inquiry