Mouse Anti-Pig ASF1B Antibody (MO-AB-23889R)


Cat: MO-AB-23889R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO23889R
SpecificityThis antibody binds to Pig ASF1B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.
Product OverviewThis product is a mouse antibody against ASF1B. It can be used for ASF1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesASF1B
UniProt IDB6DX84
Protein RefseqThe length of the protein is 202 amino acids long.
The sequence is show below: MAKVSVLNVAVLENPSPFHSPFRFEISFECNEALTDDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYPNPELRENPPLKPDFSQLQRNILASNPRVTRFHINWDNNTDRLEAIENQDPALGCGFPLSCTPIKGLGLPGCIPGLLPENSMDCI.
For Research Use Only | Not For Clinical Use.
Online Inquiry