Mouse Anti-Pig BACH2 Antibody (MO-AB-24060R)
Cat: MO-AB-24060R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO24060R |
Specificity | This antibody binds to Pig BACH2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Transcriptional regulator that acts as repressor or activator (By similarity). Binds to Maf recognition elements (MARE) (By similarity). Plays an important role in coordinating transcription activation and repression by MAFK (By similarity). Induces apoptosis in response to oxidative stress through repression of the antiapoptotic factor HMOX1. Positively regulates the nuclear import of actin (By similarity). |
Product Overview | This product is a mouse antibody against BACH2. It can be used for BACH2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | BACH2 protein, Fragment; BACH2 |
UniProt ID | M1KKH0 |
Protein Refseq | The length of the protein is 73 amino acids long. The sequence is show below: RENIREVLRCAELLRMHNLEDSCFSFLQTQLLNSEDGLFVCRKDAACQRAHEDRENSAGEEEEEEEETMDSET. |
See other products for " BACH2 "
CBMOAB-36738FYA | Mouse Anti-Rhesus BACH2 Antibody (CBMOAB-36738FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry