Mouse Anti-Pig BCL3 Antibody (MO-AB-24109R)


Cat: MO-AB-24109R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO24109R
SpecificityThis antibody binds to Pig BCL3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a proto-oncogene candidate. It is identified by its translocation into the immunoglobulin alpha-locus in some cases of B-cell leukemia. The protein encoded by this gene contains seven ankyrin repeats, which are most closely related to those found in I kappa B proteins. This protein functions as a transcriptional co-activator that activates through its association with NF-kappa B homodimers. The expression of this gene can be induced by NF-kappa B, which forms a part of the autoregulatory loop that controls the nuclear residence of p50 NF-kappa B.
Product OverviewThis product is a mouse antibody against BCL3. It can be used for BCL3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesB-cell chronic lymphatic leukemia protein 3; BCL3
UniProt IDG9M4N0
Protein RefseqThe length of the protein is 454 amino acids long.
The sequence is show below: MPRCPAGTMDEGPVDLRTRPKAGGPPGAALPLRKRPLRPPSPEPAAPRGAAGPAVPSDPLRGGSDAPAVPAPPHGLARPEAVYYPGPLLPLYPTPTMGSPFPLLNLPTPLYPMVCSMEHPLSADIAVATRADEDGDTPLHIAVVQGNLPAVHRLVSLFHHGGRELDIYNNLRQTPLHLAVITTLPSVVRLLVMAGASPMALDRHGQTAAHLACEHRSPACLRALLDSAAGGTMDLEARNYDGLTALHVAVNTECHKAVLLLLEHGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSGLKNCHNDTPLMVARSRRVIDILRGKATRPAPASQPEPSPDRSATTSPESGSRLSSNGLLSASPPSSPSQSPPKDTPGFSMAPPSFFLPPSSPPTFLPFARVLRAPGRPVPPSPAPGGS.
For Research Use Only | Not For Clinical Use.
Online Inquiry