Mouse Anti-Pig BRCA2 Antibody (MO-AB-24185R)


Cat: MO-AB-24185R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO24185R
SpecificityThis antibody binds to Pig BRCA2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionInherited mutations in BRCA1 and this gene, BRCA2, confer increased lifetime risk of developing breast or ovarian cancer. Both BRCA1 and BRCA2 are involved in maintenance of genome stability, specifically the homologous recombination pathway for double-strand DNA repair. The BRCA2 protein contains several copies of a 70 aa motif called the BRC motif, and these motifs mediate binding to the RAD51 recombinase which functions in DNA repair. BRCA2 is considered a tumor suppressor gene, as tumors with BRCA2 mutations generally exhibit loss of heterozygosity (LOH) of the wild-type allele.
Product OverviewThis product is a mouse antibody against BRCA2. It can be used for BRCA2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBreast and ovarian cancer susceptibility 2, Fragment; BRCA2
UniProt IDG5CWU3
Protein RefseqThe length of the protein is 1425 amino acids long.
The sequence is show below: SLGTILRKCSNNESHSDNKTVSQDLDYKEAKIDKEKLPSFITTETDNVSCMQKKHCEDDPKSQRVXDIKEKVLPAGRHPAVPHSEEGRDTYFQSQENFLHDLDNTTILTPSSKDLLSNPVVTSGGKESYKMSEKIKSRNXKADFELTRNISMEKNQETCVLNDSSQKAELLAPEKYLTVVSPSMKVQLNQNINLTGIQKDQEETTLISKITVSPNSEELFPDNETNFVFQTPTKRNIPVLGNIMEVHEVDLSCLREPVLKNSALVTCTDIDDEQTAKGSMTKDFVSSNRAHDLIEKNRTSVQQQPKIIQGXESKSXTSLDIAVKSNRSNDCMDSWXGLSDLIARHSFGNGFRTASNKEIKLSEHNIKKSKLLFRDLEEHYPPSLACVEIVNTLSLASQKKESKPHALDLPSVNTVSGCVQSSAILSDSENRHTTPPILSLKQDFNSNHNLTPSQKAEITELSTILEESGSQFEFTQFKKPGHITQNSLCEMPANQMTVLNTPSEEWKDPALHLTINAPSVSQAESSSKSEGIDGGKQKFACLSSSNCSRSASGYLADKNEVEFRGFYSARGTKLNVSRKALQKAMNLFSDIENVSEETSAAVGPGCFSSSKCNDSDVSIFKVENYSSDKSLSEKYNKCQLILKNNIERTADIFVEENTDGYKRNTENKDNKCTGLASNLGEADDSASSKTDTVYMHEDETGLPFIDHNIHLKLPNHFMKKGNTQIKEGLSDLTCLEVMRAEETFHINTSNKQSTVNKRSQKIKDFDVFDLSFQSASGKNIRVSKESLNKAVNFFDEKCTEEELNNFSDSSNSEILSGININKINISSHKETDSDKNKLLKESDPVGIENQLLTLQQRSECEIKKIEEPTMLGFHTASGKKVKIAKESLDKVKNLFDETKQDSSETTNSSHQGVKTQKDREVCKEELELTFETVEITASKHEEIRNFLEEKKLVSKEITMPPRLLRHHLHRQTENLSMSNSIPLKGKVHENMEEETSCHTDQSTCSAIENSALTFYTGHGRKISVNQASVFEAKKWLREGELDDQPENVDSAKVICLKECARDYVGNPLCGSSSNSIITENDKNLPEKQNSTYLSNSVSNNYSYHSDFCHSNEVLSKSESLSENKIGNSDTEPAVKNVKDRKDTCFSEEISTVREANTHPQAVDEDSWVRKLVINSTPCKNKNTPGEVSRSNSNNFEKEPPAFSTSGNIAFVSHETDVRERFADNNRKAIKQNTESMSGSCQMKIMTGAHKALGDSEDVIFPNSPDSEEHITRSQEVFPEIQSEQILQHDPSVSGLEKVSEMPPCHINLKTFDIXKFDMKRHPMSVSSMNDCGVFSTASGXSVQVSDTALQKARQVFSKTEDVAKPFFSRAVKSDEEHSDKYTREENAMMHPPPNFLSSAFSGFSTASGKQVPVSESALCKVKGMF.
For Research Use Only | Not For Clinical Use.
Online Inquiry