Mouse Anti-Pig CCR6 Antibody (MO-AB-24410R)
Cat: MO-AB-24410R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO24410R |
Specificity | This antibody binds to Pig CCR6. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CCR6 (C-C Motif Chemokine Receptor 6) is a Protein Coding gene. Diseases associated with CCR6 include Limited Scleroderma and Diffuse Cutaneous Systemic Sclerosis. Among its related pathways are Defensins and Akt Signaling. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and chemokine receptor activity. An important paralog of this gene is CCR7. |
Product Overview | This product is a mouse antibody against CCR6. It can be used for CCR6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Chemokine (C-C motif) receptor 6, Fragment; CCR6 |
UniProt ID | A0FEV7 |
Protein Refseq | The length of the protein is 63 amino acids long. The sequence is show below: LVTAVNLGRTDRSCGSERALGYARNITEVLAFLHCCLNPVLYAFIGQKFRSYFLKIMKDLWCV. |
See other products for " CCR6 "
MO-AB-34509W | Mouse Anti-Ferret CCR6 Antibody (MO-AB-34509W) |
MO-AB-01030Y | Mouse Anti-Chicken CCR6 Antibody (MO-AB-01030Y) |
CBMOAB-38599FYA | Mouse Anti-Rhesus CCR6 Antibody (CBMOAB-38599FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry