Mouse Anti-Pig CD81 Antibody (MO-AB-24490R)


Cat: MO-AB-24490R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO24490R
SpecificityThis antibody binds to Pig CD81.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Plasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD81 (CD81 Molecule) is a Protein Coding gene. Diseases associated with CD81 include Immunodeficiency, Common Variable, 6 and Common Variable Immunodeficiency. Among its related pathways are Innate Immune System and B cell receptor signaling pathway (KEGG). Gene Ontology (GO) annotations related to this gene include MHC class II protein complex binding. An important paralog of this gene is CD9.
Product OverviewThis product is a mouse antibody against CD81. It can be used for CD81 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTetraspanin; CD81
UniProt IDA7WLI1
Protein RefseqThe length of the protein is 236 amino acids long.
The sequence is show below: MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTSLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAIVDDDANNAKAVVKTFHETLNCCGSNTLTTLTTSVLKNSLCPSGGNIISNLMKEDCHSKIDELFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY.
For Research Use Only | Not For Clinical Use.
Online Inquiry