Mouse Anti-Pig CDC16 Antibody (MO-AB-24512R)
Cat: MO-AB-24512R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO24512R |
Specificity | This antibody binds to Pig CDC16. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CDC16 (Cell Division Cycle 16) is a Protein Coding gene. Among its related pathways are PAK Pathway and Actin Nucleation by ARP-WASP Complex. |
Product Overview | This product is a mouse antibody against CDC16. It can be used for CDC16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cell division cycle 16-like protein, Fragment; CDC16 |
UniProt ID | Q3HNA9 |
Protein Refseq | The length of the protein is 52 amino acids long. The sequence is show below: QENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKGPFHANCLPVHIGTLVELN. |
See other products for " CDC16 "
MO-AB-00091W | Mouse Anti-Barrel medic CDC16 Antibody (MO-AB-00091W) |
MO-AB-20932W | Mouse Anti-Chimpanzee CDC16 Antibody (MO-AB-20932W) |
CBMOAB-38773FYA | Mouse Anti-Rhesus CDC16 Antibody (CBMOAB-38773FYA) |
MO-AB-02223H | Mouse Anti-Frog cdc16 Antibody (MO-AB-02223H) |
CBMOAB-69760FYA | Mouse Anti-Zebrafish cdc16 Antibody (CBMOAB-69760FYA) |
CBMOAB-00655CR | Mouse Anti-Yeast CDC16 Antibody (CBMOAB-00655CR) |
CBMOAB-03236FYA | Mouse Anti-D. melanogaster Cdc16 Antibody (CBMOAB-03236FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry