Mouse Anti-Pig COL1A1 Antibody (MO-AB-24735R)
Cat: MO-AB-24735R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO24735R |
Specificity | This antibody binds to Pig COL1A1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | COL1A1 (Collagen Type I Alpha 1 Chain) is a Protein Coding gene. Diseases associated with COL1A1 include Caffey Disease and Osteogenesis Imperfecta, Type I. Among its related pathways are Integrin Pathway and ERK Signaling. Gene Ontology (GO) annotations related to this gene include identical protein binding and platelet-derived growth factor binding. An important paralog of this gene is COL2A1. |
Product Overview | This product is a mouse antibody against COL1A1. It can be used for COL1A1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Collagen alpha-1(I, Fragment; COL1A1 |
UniProt ID | Q1HNM7 |
Protein Refseq | The length of the protein is 83 amino acids long. The sequence is show below: PPVTCVQNGLRYHDRDVWKPVPCQICVCDNGNVLCDDVICDEIKNCPSARVPAGECCPVCPEGEVSPTDQETTGVEGPKGDTG. |
See other products for " COL1A1 "
MO-AB-07661Y | Mouse Anti-Rabbit COL1A1 Antibody (MO-AB-07661Y) |
MO-AB-34181W | Mouse Anti-Donkey COL1A1 Antibody (MO-AB-34181W) |
CBMOAB-39630FYA | Mouse Anti-Rhesus COL1A1 Antibody (CBMOAB-39630FYA) |
MO-AB-32970H | Mouse Anti-Nile tilapia COL1A1 Antibody (MO-AB-32970H) |
MO-AB-53332W | Mouse Anti-Marmoset COL1A1 Antibody (MO-AB-53332W) |
MO-AB-14675Y | Mouse Anti-Sheep COL1A1 Antibody (MO-AB-14675Y) |
MO-AB-11010Y | Mouse Anti-O. mykiss COL1A1 Antibody (MO-AB-11010Y) |
MOFY-0522-FY83 | Mouse Anti-COL1A1 Antibody (MOFY-0522-FY83) |
MO-AB-24958H | Mouse Anti-Rat Col1a1 Antibody (MO-AB-24958H) |
MO-AB-02547H | Mouse Anti-Frog col1a1 Antibody (MO-AB-02547H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry