AibGenesis™ Mouse Anti-CST11 Antibody (MO-AB-24933R)


Cat: MO-AB-24933R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-24933R Monoclonal Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO24933R 100 µg
MO-AB-25157H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25157C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO24933R
SpecificityThis antibody binds to Pig CST11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against CST11. It can be used for CST11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCystatin 11, Fragment; CST11
UniProt IDC7C1I5
Protein RefseqThe length of the protein is 68 amino acids long.
The sequence is show below: VAFSYQTKKKSFIHVQELPVSDPFVVTTLDFVSKEFNKKSEDKYNFRIVRVLKAVQVLTNHLEYRLNL.
For Research Use Only | Not For Clinical Use.
Online Inquiry