Mouse Anti-Pig CX3CL1 Antibody (MO-AB-24983R)
Cat: MO-AB-24983R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO24983R |
Specificity | This antibody binds to Pig CX3CL1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | This product is a mouse antibody against CX3CL1. It can be used for CX3CL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Chemokine (C-X3-C motif) ligand 1, Fragment; CX3CL1 |
UniProt ID | A0FEV8 |
Protein Refseq | The length of the protein is 54 amino acids long. The sequence is show below: LSTSIPDSHAATRRQAVGLLAFLGLLFFLGVAMFAYQSLQGCSRKMSGDMAEGL. |
See other products for " CX3CL1 "
MO-AB-53763W | Mouse Anti-Marmoset CX3CL1 Antibody (MO-AB-53763W) |
MO-AB-01476Y | Mouse Anti-Chicken CX3CL1 Antibody (MO-AB-01476Y) |
MO-AB-29958W | Mouse Anti-Dog CX3CL1 Antibody (MO-AB-29958W) |
MO-AB-12988W | Mouse Anti-Chimpanzee CX3CL1 Antibody (MO-AB-12988W) |
CBMOAB-40148FYA | Mouse Anti-Rhesus CX3CL1 Antibody (CBMOAB-40148FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry