Mouse Anti-Pig CXCL9 Antibody (MO-AB-24993R)


Cat: MO-AB-24993R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO24993R
SpecificityThis antibody binds to Pig CXCL9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Plasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCXCL9 (C-X-C Motif Chemokine Ligand 9) is a Protein Coding gene. Diseases associated with CXCL9 include Endotheliitis and Sydenham Chorea. Among its related pathways are PEDF Induced Signaling and Akt Signaling. Gene Ontology (GO) annotations related to this gene include cytokine activity and CXCR3 chemokine receptor binding. An important paralog of this gene is CXCL10.
Product OverviewThis product is a mouse antibody against CXCL9. It can be used for CXCL9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-X-C motif chemokine; CXCL9
UniProt IDB0FYK2
Protein RefseqThe length of the protein is 126 amino acids long.
The sequence is show below: MKKSSVALLLGIIFLTLIGVQGTLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT.
For Research Use Only | Not For Clinical Use.
Online Inquiry