Mouse Anti-Pig CYBRD1 Antibody (MO-AB-25000R)


Cat: MO-AB-25000R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO25000R
SpecificityThis antibody binds to Pig CYBRD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYBRD1 (Cytochrome B Reductase 1) is a Protein Coding gene. Diseases associated with CYBRD1 include Hemochromatosis, Type 1 and Iron Metabolism Disease. Among its related pathways are Insulin receptor recycling and Mineral absorption. Gene Ontology (GO) annotations related to this gene include ferric-chelate reductase activity and oxidoreductase activity, oxidizing metal ions. An important paralog of this gene is CYB561A3.
Product OverviewThis product is a mouse antibody against CYBRD1. It can be used for CYBRD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome b reductase 1; CYBRD1
UniProt IDK9J4U1
Protein RefseqThe length of the protein is 285 amino acids long.
The sequence is show below: MAMEGYRGFLALLVSALLVGFLSVIFTLIWVLHYREGLGWDGTALEFNWHPVLIVTGFVFIQGIAIIVYRLPWTWKCSKLLMKSIHAGLNTVAAILAIISLVAVFDFHNARKIPNMYSLHSWVGLAAVILYMLQLLLGFFVFLLPWAPLSLRALLMPIHVYSGLLIFGTVIATVLMGVTEKLIFALQSPAYSTLPPEGVFTNTFGLLVLVFGALIFWIVTRPQWKRPKEPNSVLLHPNRGAPEGAEGTMAVNFGNMDKSDSELNSEAAARKRNFALDEAGQRSTM.
For Research Use Only | Not For Clinical Use.
Online Inquiry