Mouse Anti-Pig FMO1 Antibody (MO-AB-25876R)
Cat: MO-AB-25876R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO25876R |
Specificity | This antibody binds to Pig FMO1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013] |
Product Overview | This product is a mouse antibody against FMO1. It can be used for FMO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Flavin-containing monooxygenase 1, Fragment; FMO1 |
UniProt ID | A3QT03 |
Protein Refseq | The length of the protein is 60 amino acids long. The sequence is show below: FPFLDESVVKVEDGQASLYKYIFPAHLQKPTLAVIGLIKPLGSLLPTGDTQARWAVRVLK. |
See other products for " FMO1 "
MO-AB-55556W | Mouse Anti-Marmoset FMO1 Antibody (MO-AB-55556W) |
MO-AB-15288Y | Mouse Anti-Sheep FMO1 Antibody (MO-AB-15288Y) |
MO-AB-69813W | Mouse Anti-Silkworm FMO1 Antibody (MO-AB-69813W) |
MO-AB-06487Y | Mouse Anti-O. anatinus FMO1 Antibody (MO-AB-06487Y) |
CBMOAB-01349CR | Mouse Anti-Yeast FMO1 Antibody (CBMOAB-01349CR) |
MO-AB-34774W | Mouse Anti-Ferret FMO1 Antibody (MO-AB-34774W) |
MO-AB-07953W | Mouse Anti-Cat FMO1 Antibody (MO-AB-07953W) |
MO-AB-30817W | Mouse Anti-Dog FMO1 Antibody (MO-AB-30817W) |
MO-AB-12493W | Mouse Anti-Chimpanzee FMO1 Antibody (MO-AB-12493W) |
MO-DKB-02919W | Rabbit Anti-FMO1 Antibody (MO-DKB-02919W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry