Mouse Anti-Pig FOXP3 Antibody (MO-AB-25901R)


Cat: MO-AB-25901R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO25901R
SpecificityThis antibody binds to Pig FOXP3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX), also known as X-linked autoimmunity-immunodeficiency syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Product OverviewThis product is a mouse antibody against FOXP3. It can be used for FOXP3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesForkhead box P3; FOXP3
UniProt IDQ6BBQ1
Protein RefseqThe length of the protein is 431 amino acids long.
The sequence is show below: MPNPRPAKPLAPSSVLSPSPGASPSWRAVPKTSDQQGAKGPGAAFQGRELRGGAHASSSSLNPMPPSQLQLPTVPLVMVAPSGARLGPSPHLQALLQDRPHFVHQLSTVDAHARTPVLQVRPLDSPAMISLPPPTAATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPSPGVPRKDSTLSTVPQGSYSLLANGVCKWPGCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREVVQSLEQQLVLEKEKLGAMQAHLAGKMPSPKAPSAASSDKGSCCIVATGTPGTAVPAWPGPQEAPDGLFAVRRHLWGSHGNSTFPDFFHNMEYFKFHNMRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDEFEFRKKRSQRPSRCSNPTPGP.
See other products for " Foxp3 "
MO-AB-25886HMouse Anti-Rat Foxp3 Antibody (MO-AB-25886H)
MO-AB-70683WMouse Anti-Foxp3 (N-terminus, clone 5F4) Antibody (MO-AB-70683W)
MO-AB-44792WMouse Anti-Horse FOXP3 Antibody (MO-AB-44792W)
MO-AB-12684RMouse Anti-Cattle Foxp3 Antibody (MO-AB-12684R)
MO-AB-03692HMouse Anti-Frog foxp3 Antibody (MO-AB-03692H)
MO-AB-21685WMouse Anti-Chimpanzee FOXP3 Antibody (MO-AB-21685W)
MO-AB-09374WMouse Anti-Cat FoxP3 Antibody (MO-AB-09374W)
MO-DKB-00668WRabbit Anti-FOXP3 Antibody (MO-DKB-00668W)
CBMOAB-43118FYAMouse Anti-Rhesus FOXP3 Antibody (CBMOAB-43118FYA)
MO-AB-15299YMouse Anti-Sheep FOXP3 Antibody (MO-AB-15299Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry