Mouse Anti-Pig ITGB5 Antibody (MO-AB-26754R)
Cat: MO-AB-26754R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO26754R |
Specificity | This antibody binds to Pig ITGB5. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a beta subunit of integrin, which can combine with different alpha chains to form a variety of integrin heterodimers. Integrins are integral cell-surface receptors that participate in cell adhesion as well as cell-surface mediated signaling. The alphav beta5 integrin is involved in adhesion to vitronectin. |
Product Overview | This product is a mouse antibody against ITGB5. It can be used for ITGB5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Integrin beta 5, Fragment; ITGB5 |
UniProt ID | A4GVX5 |
Protein Refseq | The length of the protein is 35 amino acids long. The sequence is show below: EAVLCFYKTAKDCVMMFTYAELPSGKSNLTVLKEP. |
See other products for " ITGB5 "
MO-AB-31339W | Mouse Anti-Dog ITGB5 Antibody (MO-AB-31339W) |
CBMOAB-81290FYA | Mouse Anti-Zebrafish itgb5 Antibody (CBMOAB-81290FYA) |
MO-AB-09479W | Mouse Anti-Cat ITGB5 Antibody (MO-AB-09479W) |
MO-AB-15842Y | Mouse Anti-Sheep ITGB5 Antibody (MO-AB-15842Y) |
MO-AB-04566H | Mouse Anti-Frog itgb5 Antibody (MO-AB-04566H) |
MO-AB-45206W | Mouse Anti-Horse ITGB5 Antibody (MO-AB-45206W) |
MO-AB-14339R | Mouse Anti-Cattle ITGB5 Antibody (MO-AB-14339R) |
MO-AB-08523Y | Mouse Anti-Rabbit ITGB5 Antibody (MO-AB-08523Y) |
MO-AB-00682L | Mouse Anti-Elephant ITGB5 Antibody (MO-AB-00682L) |
MO-AB-23335H | Mouse Anti-Mallard ITGB5 Antibody (MO-AB-23335H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry