Mouse Anti-Pig LIPA Antibody (MO-AB-27018R)


Cat: MO-AB-27018R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO27018R
SpecificityThis antibody binds to Pig LIPA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives. Free octanoate is not a substrate for LipA.
Product OverviewThis product is a mouse antibody against LIPA. It can be used for LIPA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLipase; LIPA
UniProt IDF1SCY4
Protein RefseqThe length of the protein is 399 amino acids long.
The sequence is show below: MGMWLLGLVVCLVLGPLHSEASRGKPAPVDPEINMNVSEIISHWGYPSEEHFVVTADGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVVNLPKNSLGFILADAGFDVWMGNSRGNTWSRKHKTLSISQEEYWAFSYDEMANYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSRIPELAKKVKMFFALAPVVSVQFATSPLVKLGQIPDHLIKDLFGVKEFLPQSAFLKWLSTHVCAHVILKELCGNIVFVLCGFNERNLNMSRVAVYTAHSPAGTSVQDMLHWSQVVKFKKFQAFDWGSSAKNYFHYNQSHPPLYNVKDMLVRTAIWSGGRDWLADVQDVSVLLTQIPNLVYHKHIHKWEHLDFIWGLDAPQQLYDEMINLMRKYQ.
See other products for " LIPA "
MO-AB-42016WMouse Anti-Guinea pig LIPA Antibody (MO-AB-42016W)
CBMOAB-1501YCMouse Anti-E. coli lipA Antibody (CBMOAB-1501YC)
MO-DKB-01123WRabbit Anti-LIPA Antibody (MO-DKB-01123W)
MO-AB-31618WMouse Anti-Dog LIPA Antibody (MO-AB-31618W)
MO-AB-08629WMouse Anti-Cat LIPA Antibody (MO-AB-08629W)
MO-AB-45373WMouse Anti-Horse LIPA Antibody (MO-AB-45373W)
MO-AB-58228WMouse Anti-Marmoset LIPA Antibody (MO-AB-58228W)
MO-AB-08708YMouse Anti-Rabbit LIPA Antibody (MO-AB-08708Y)
MO-AB-19306WMouse Anti-Chimpanzee LIPA Antibody (MO-AB-19306W)
MO-AB-14957RMouse Anti-Cattle LIPA Antibody (MO-AB-14957R)
For Research Use Only | Not For Clinical Use.
Online Inquiry