Mouse Anti-Pig MANF Antibody (MO-AB-27121R)


Cat: MO-AB-27121R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO27121R
SpecificityThis antibody binds to Pig MANF.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted. Reducing expression of this gene increases susceptibility to ER stress-induced death and results in cell proliferation. Activity of this protein is important in promoting the survival of dopaminergic neurons. The presence of polymorphisms in the N-terminal arginine-rich region, including a specific mutation that changes an ATG start codon to AGG, have been reported in a variety of solid tumors; however, these polymorphisms were later shown to exist in normal tissues and are thus no longer thought to be tumor-related.
Product OverviewThis product is a mouse antibody against MANF. It can be used for MANF detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMesencephalic astrocyte-derived neurotrophic factor; MANF
UniProt IDE0YLM4
Protein RefseqThe length of the protein is 179 amino acids long.
The sequence is show below: MWFTHGLAVALALSVLPASRALRPGDCEVCISYLGRFYQDLKDRDVTFSPASIEKELTKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASSRTDL.
For Research Use Only | Not For Clinical Use.
Online Inquiry