Mouse Anti-Pig RPL6 Antibody (MO-AB-28861R)
Cat: MO-AB-28861R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO28861R |
Specificity | This antibody binds to Pig RPL6. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a protein component of the 60S ribosomal subunit. This protein can bind specifically to domain C of the tax-responsive enhancer element of human T-cell leukemia virus type 1, and may participate in tax-mediated transactivation of transcription. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed throughout the genome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Product Overview | This product is a mouse antibody against RPL6. It can be used for RPL6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Ribosome protein L6, Fragment; RPL6 |
UniProt ID | Q30C42 |
Protein Refseq | The length of the protein is 54 amino acids long. The sequence is show below: SRNPVLVRGIGRYSRSAMYSRKALYKRKYSAAKSKVEKKKKVRVLATVTKPVGG. |
See other products for " RPL6 "
CBMOAB-56776FYA | Mouse Anti-Rhesus RPL6 Antibody (CBMOAB-56776FYA) |
MO-AB-06850Y | Mouse Anti-O. anatinus RPL6 Antibody (MO-AB-06850Y) |
CBMOAB-09329HCB | Mouse Anti-C. elegans RPL6 Antibody (CBMOAB-09329HCB) |
MO-DKB-00720W | Rabbit Anti-RPL6 Antibody (MO-DKB-00720W) |
MO-AB-70330W | Mouse Anti-Silkworm RpL6 Antibody (MO-AB-70330W) |
MO-AB-12052W | Mouse Anti-Chimpanzee RPL6 Antibody (MO-AB-12052W) |
MO-AB-33145W | Mouse Anti-Dog RPL6 Antibody (MO-AB-33145W) |
MO-AB-07903W | Mouse Anti-Cat RPL6 Antibody (MO-AB-07903W) |
MO-AB-07258H | Mouse Anti-Frog rpl6 Antibody (MO-AB-07258H) |
MO-AB-01285L | Mouse Anti-Elephant RPL6 Antibody (MO-AB-01285L) |
For Research Use Only | Not For Clinical Use.
Online Inquiry