Mouse Anti-Pig TAF1B Antibody (MO-AB-30567R)


Cat: MO-AB-30567R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO30567R
SpecificityThis antibody binds to Pig TAF1B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionInitiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes one of the SL1-specific TAFs. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewThis product is a mouse antibody against TAF1B. It can be used for TAF1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTATA box binding protein (TBP) associated factor, Fragment; TAF1B
UniProt IDQ9N0I9
Protein RefseqThe length of the protein is 117 amino acids long.
The sequence is show below: FQHILCQQAEALQTLGVGPELKDEVLHNFWKRYLQKSKQAYCKNPVHTSRRKTTVLEDNPSHSDWDSEPELLSDFSCPPICESGAESQPDVHTQKPFRIIKASHSETSVCSGSLDGV.
For Research Use Only | Not For Clinical Use.
Online Inquiry