Mouse Anti-PIGU Antibody (MO-AB-28299R)


Cat: MO-AB-28299R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-28299R Monoclonal Pig (Sus scrofa), Chimpanzee (Pan troglodytes), Hamsters (Cricetinae), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO28299R 100 µg
CBMOAB-54543FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO54543FYA 100 µg
CBMOAB-92599FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92599FYA 100 µg
MO-AB-10906W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10906W 100 µg
MO-AB-43361W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43361W 100 µg
MO-AB-61524W Monoclonal Marmoset WB, ELISA MO61524W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa), Chimpanzee (Pan troglodytes), Hamsters (Cricetinae), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO28299R
SpecificityThis antibody binds to Pig PIGU.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene shares similarity with Saccharomyces cerevisiae Cdc91, a predicted integral membrane protein that may function in cell division control. The protein encoded by this gene is the fifth subunit of GPI transamidase that attaches GPI-anchors to proteins. (From NCBI)
Product OverviewThis product is a mouse antibody against PIGU. It can be used for PIGU detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPhosphatidylinositol glycan anchor biosynthesis, class U; PIGU
UniProt IDD0G6R5
Protein RefseqThe length of the protein is 435 amino acids long.
The sequence is show below: MAAPLALVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPLIIYLFHFLIDYAELVFMITDALTAIALYFAIQDFNKVVFKKQKLLLELDQYAPDVAELIRTPMEMRHIPLKVAVFYLLNPYTVLSCVAKSTCAINNTLIAFFILTTMKGSAFLSAIFLALATYQSLYPLTLFVPGLLYLLQRQYIPVKVKSKAFWIFSWEYAMMYVGSLVVIVCLSFFLLSSWDFIPAVYGFILSVPDLTPNIGLFWYFFAEMFEHFSLFFVCVFQINVFFYTIPLAIKLKEHPVFFMFIQIAIISIFKSYPTVGDVALYMAFFPVWNHLYRFLRNIFVLTCIIIACSLLFPVLWHLWIYAGSANSNFFYAITLTFNVGQILLISDYFYAFLRREYYLTHGLYLTAKDGTEAMLVLK.
For Research Use Only | Not For Clinical Use.
Online Inquiry