AibGenesis™ Mouse Anti-PIGV Antibody (CBMOAB-54544FYA)


Cat: CBMOAB-54544FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54544FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO54544FYA 100 µg
CBMOAB-92601FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92601FYA 100 µg
MO-AB-26573W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26573W 100 µg
MO-AB-28300R Monoclonal Pig (Sus scrofa) WB, ELISA MO28300R 100 µg
MO-AB-61525W Monoclonal Marmoset WB, ELISA MO61525W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO54544FYA
SpecificityThis antibody binds to Rhesus PIGV.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a mannosyltransferase enzyme involved in the biosynthesis of glycosylphosphatidylinositol (GPI). GPI is a complex glycolipid that functions as a membrane anchor for many proteins and plays a role in multiple cellular processes including protein sorting and signal transduction. The encoded protein is localized to the endoplasmic reticulum and transfers the second mannose to the GPI backbone. Mutations in this gene are associated with hyperphosphatasia cognitive disability syndrome. Alternatively spliced transcript variants have been observed for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus PIGV Antibody is a mouse antibody against PIGV. It can be used for PIGV detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPIGV
UniProt IDF7GM82
Protein RefseqThe length of the protein is 265 amino acids long.
The sequence is show below: MPSSQITTQKPSLLLAWPPQALWTNLWTYYAYTQFCLPGSARPIPEPLVQLAVDKGYRIAEGNEPPWCFWDVPLIYSYIQDVYWNVGFLKYYELRQVPNFLLAAPVAILVVWATWTYVTTHPWLCLTLGLQRSKNNKTLEKPDLGFLSPKVFVYLVHAAVLLLFGGLCMHVQVLTRFLGSSTPIVYWFPAHLLQDQEPLLRSLKTVPWKPLAEDSPPGQKVPRNPIMGLLYRWKTCSPVTRYILGYFLTYWLLGLLLHCNFLPWT.
For Research Use Only | Not For Clinical Use.
Online Inquiry