Mouse Anti-PIN4 Antibody (MO-AB-00485W)


Cat: MO-AB-00485W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00485W Monoclonal Barrel medic (Medicago truncatula), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Frog (Xenopus laevis), Rat (Rattus norvegicus), Rice (Oryza), Yeast, Zebrafish (Danio rerio) WB, ELISA MO00485W 100 µg
CBMOAB-38876FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO38876FC 100 µg
CBMOAB-92664FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92664FYA 100 µg
CBMOAB-02993CR Monoclonal Yeast WB, ELISA MO02993CR 100 µg
CBMOAB-88708FYB Monoclonal Rice (Oryza) WB, ELISA MO88708FYB 100 µg
MO-AB-17943R Monoclonal Cattle (Bos taurus) WB, ELISA MO17943R 100 µg
MO-AB-06277H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06277C 100 µg
MO-AB-27883H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27883C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityBarrel medic (Medicago truncatula), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Frog (Xenopus laevis), Rat (Rattus norvegicus), Rice (Oryza), Yeast, Zebrafish (Danio rerio)
CloneMO00485W
SpecificityThis antibody binds to Barrel medic PIN4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ribosome biogenesis. The encoded protein may play an additional role in the mitochondria. (From NCBI)
Product OverviewMouse Anti-Barrel medic PIN4 Antibody is a mouse antibody against PIN4. It can be used for PIN4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAuxin efflux carrier family transporter; Auxin efflux carrier protein; PIN4; MTR_6g069510
UniProt IDQ8GV74
Protein RefseqThe length of the protein is 604 amino acids long.
The sequence is show below: MITLTDFYHVMTAMVPLYVAMILAYGSVKWWKIFSPDQCSGINRFVALFAVPLLSFHFIASNNPYKMNLRFLAADTLQKLIILCLLAIWSNFSKRGCLEWTITLFSLSTLPNTLVMGIPLLKGMYGEFSGSLMVQIVVLQCIIWYTLMLFMFEFRGARLLISEQFPDTAGSIVSIHVDSDVMSLDGRTPLETDAEIKEDGKLHITVRKSNASRSDIYSRRSQGLSSNTPRPSNLTNAEIYSLQSSRNPTPRGSSFNHTDFYSMMGGGNGRNSNFGANDVVNNYGLSANSRGVTPRPSNYEEEANNNAKKFKNYPAPNPGMFSPTNNNNGSKNLGSNVSVNAKKSNGQSQQKQEDLHMFVWSSSASPVSDVFGGHDFGAHDQKEVKLNVSPGKVEGHRETQEDYLEKDEFSFGNKGMEREMNQHEGGEKGGDGKSKVMPPASVMTRLILIMVWRKLIRNPNTYSSLIGLTWSLVSFRYHIEMPAIIAKSISILSDAGLGMAMFSLGLFMALQPKIIACGNSIAAFSMGVRFLVGPAVMAAASFAVGLKGVLFHVAIVQAALPQGIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILMGL.
See other products for " PIN4 "
For Research Use Only | Not For Clinical Use.
Online Inquiry