AibGenesis™ Mouse Anti-PINX1 Antibody (CBMOAB-54571FYA)


Cat: CBMOAB-54571FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54571FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO54571FYA 100 µg
CBMOAB-92670FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92670FYA 100 µg
MO-AB-06279H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06279C 100 µg
MO-AB-17945R Monoclonal Cattle (Bos taurus) WB, ELISA MO17945R 100 µg
MO-AB-24224W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24224W 100 µg
MO-AB-61557W Monoclonal Marmoset WB, ELISA MO61557W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO54571FYA
SpecificityThis antibody binds to Rhesus PINX1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PINX1 Antibody is a mouse antibody against PINX1. It can be used for PINX1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPIN2/TERF1-interacting telomerase inhibitor 1; PINX1
UniProt IDH9FWC1
Protein RefseqThe length of the protein is 328 amino acids long.
The sequence is show below: MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETADSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPDENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDTSKTQVEHKRGKKRNKEATGEDVESYPQPKAKRDMEGKPERAKAQERVAKKSGPAEEQLRGPCWDQSSEASAPDAGDHVQPPEGGDFTLKPKKRRGKKKPQKPVEIAEDATPEETPVKKKKKKKDSK.
For Research Use Only | Not For Clinical Use.
Online Inquiry