Mouse Anti-PLAC1 Antibody (MO-AB-18018R)


Cat: MO-AB-18018R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-18018R Monoclonal Cattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO18018R 100 µg
MO-AB-27917H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27917C 100 µg
MO-AB-28353R Monoclonal Pig (Sus scrofa) WB, ELISA MO28353R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO18018R
SpecificityThis antibody binds to Cattle PLAC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against PLAC1. It can be used for PLAC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPlacenta-specific 1; PLAC1
UniProt IDQ32KZ6
Protein RefseqThe length of the protein is 179 amino acids long.
The sequence is show below: MKVFELIRELIILTSVFSACSGQNPVTVLCSTDWFMVTVHPFMLNNEVYVHFHELYLGLGCPANHVQPHAYQFTYRVTECGIRAKAVSQDMVLYSSEIYYISKHTSSKYVIPVSCTAPLCSPWLTTSCSRNLAPNGGVTTRNGETCYEVFTLSQSSQRPNCYCLSCVYNERGQSRAPRH.
For Research Use Only | Not For Clinical Use.
Online Inquiry