AibGenesis™ Mouse Anti-plekhb2 Antibody (CBMOAB-92950FYA)


Cat: CBMOAB-92950FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-92950FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO92950FYA 100 µg
MO-AB-03465Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03465Y 100 µg
MO-AB-05198W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05198W 100 µg
MO-AB-06322H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06322C 100 µg
MO-AB-11978W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11978W 100 µg
MO-AB-18066R Monoclonal Cattle (Bos taurus) WB, ELISA MO18066R 100 µg
MO-AB-27927H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27927C 100 µg
MO-AB-61728W Monoclonal Marmoset WB, ELISA MO61728W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO92950FYA
SpecificityThis antibody binds to Zebrafish plekhb2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish plekhb2 Antibody is a mouse antibody against plekhb2. It can be used for plekhb2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:55604; plekhb
UniProt IDQ7ZVV3
Protein RefseqThe length of the protein is 223 amino acids long.
The sequence is show below: MAFVKSGWLHRQSTILRRWKKNWFDLWSDGRLVFYDDQQRRDMEDEIHMKVDCINIRNASACRELAPPEGKGKDSLLQIVCRDGRVISICADSADDALAWTMALQDARLNTVVAPPQMGFVEDPVASAPPPYSELNPTPQVFYPDGYGGYVPHPPPYATQMVYSADGQQYAVAYPYHYQGGFTQPVNHVIVQERRREDTGDVALGMLAGAATGLALGSLFSVF.
For Research Use Only | Not For Clinical Use.
Online Inquiry